RetrogeneDB ID: | retro_tbel_433 | ||
Retrocopy location | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | GeneScaffold_2078:7..243(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MPC2 | ||
| Ensembl ID: | ENSTBEG00000014189 | ||
| Aliases: | None | ||
| Description: | mitochondrial pyruvate carrier 2 [Source:HGNC Symbol;Acc:24515] |
| Percent Identity: | 81.25 % |
| Parental protein coverage: | 87.78 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | KWGLVCAGLADMARPAEKLSTAQSTVL-MATGLIWSRYSLVIIPKNWSLFAVNFFVGAAGASQLFRIWRY |
| .WGL.CAGLAD.ARPAEKLSTAQSTV..MATGLIWSR.SL..IPK..SL.AV.FFVGAAGA.QLFRIWRY | |
| Retrocopy | EWGLACAGLADVARPAEKLSTAQSTVR<MATGLIWSRCSLGFIPKT*SLSAVDFFVGAAGAPQLFRIWRY |
| Parental | NQELKAKANK |
| NQELKA.A.K | |
| Retrocopy | NQELKAPASK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |