RetrogeneDB ID: | retro_cpor_570 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_2:14476770..14477123(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PFDN6 | ||
| Ensembl ID: | ENSCPOG00000019520 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 65.83 % |
| Parental protein coverage: | 90.84 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQEL- |
| MAELIQKKLQ.EVEKYQQLQKDLSK.M.GR.KLEAQLT.N.I.KEEL.LL.G...VF.LLG..LVKQE.. | |
| Retrocopy | MAELIQKKLQREVEKYQQLQKDLSKFMLGRKKLEAQLTGNSILKEELTLLNGPVWVFTLLGSLLVKQEM< |
| Parental | GEARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFRRAQ |
| GEA.AT....LDYI.AE.K.YE.Q..D....S.QQRE.L.QL...F...Q | |
| Retrocopy | GEAQAT-EEMLDYIAAEMKQYEPQIQDF*W*SKQQREILGQL*EVFWQVQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 18 .92 RPM |
| SRP017611_kidney | 0 .00 RPM | 18 .32 RPM |
| SRP017611_liver | 0 .00 RPM | 18 .24 RPM |
| SRP040447_lung | 0 .00 RPM | 11 .55 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 12 .39 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001576 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000010723 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000019520 | 1 retrocopy |
retro_cpor_570 ,
|
| Dipodomys ordii | ENSDORG00000013828 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000016778 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000000922 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024309 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000010559 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000028341 | 4 retrocopies | |
| Ochotona princeps | ENSOPRG00000000983 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000000473 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000006330 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000013280 | 1 retrocopy |