RetrogeneDB ID: | retro_cpor_570 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_2:14476770..14477123(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PFDN6 | ||
Ensembl ID: | ENSCPOG00000019520 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 65.83 % |
Parental protein coverage: | 90.84 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 1 |
Parental | MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQEL- |
MAELIQKKLQ.EVEKYQQLQKDLSK.M.GR.KLEAQLT.N.I.KEEL.LL.G...VF.LLG..LVKQE.. | |
Retrocopy | MAELIQKKLQREVEKYQQLQKDLSKFMLGRKKLEAQLTGNSILKEELTLLNGPVWVFTLLGSLLVKQEM< |
Parental | GEARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFRRAQ |
GEA.AT....LDYI.AE.K.YE.Q..D....S.QQRE.L.QL...F...Q | |
Retrocopy | GEAQAT-EEMLDYIAAEMKQYEPQIQDF*W*SKQQREILGQL*EVFWQVQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 18 .92 RPM |
SRP017611_kidney | 0 .00 RPM | 18 .32 RPM |
SRP017611_liver | 0 .00 RPM | 18 .24 RPM |
SRP040447_lung | 0 .00 RPM | 11 .55 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 12 .39 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000001576 | 2 retrocopies | |
Bos taurus | ENSBTAG00000010723 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000019520 | 1 retrocopy |
retro_cpor_570 ,
|
Dipodomys ordii | ENSDORG00000013828 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000016778 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000000922 | 1 retrocopy | |
Mus musculus | ENSMUSG00000024309 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000010559 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000028341 | 4 retrocopies | |
Ochotona princeps | ENSOPRG00000000983 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000000473 | 2 retrocopies | |
Sorex araneus | ENSSARG00000006330 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000013280 | 1 retrocopy |