RetrogeneDB ID: | retro_cpor_775 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_27:14747477..14747918(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PRR3 | ||
| Ensembl ID: | ENSCPOG00000022770 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 51.66 % |
| Parental protein coverage: | 78.49 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 4 |
| Parental | PTLPDREETGDEE-ESPIGPPSLLGPPPMANGEPGDPT-PAFRRGPPGSRRLRIPPLLSLPPPPRGRGPF |
| P.LP...ETGDEE.E.P..P.S.LG..P.ANG.P.DP...A..RGPPG.....IP..LSLP.PP.G.... | |
| Retrocopy | PPLPEWKETGDEENENPTRPHSRLGLHPTANGKPADPK>SALQRGPPGPAGPMIPSMLSLPSPPSGSDLI |
| Parental | RGGLGPRTGPYGRGWWG-VNAEPLFRGPGHRGPPRESFYKE-QTNPRRLRSWSLAKRTCPPKDS-PQVVE |
| ..GLGPR...Y..G.W..V.AEPLF....HR.P..ESF..E...NP..L.SWS....T..PK...PQV.E | |
| Retrocopy | KRGLGPRPTLYVHG*WE>VSAEPLFLQLNHRNPSGESFQEE<AENPQGL*SWSPIRIT*VPKGA<PQVRE |
| Parental | DKSNRPVCRHF |
| DKSN..VC..F | |
| Retrocopy | DKSNCLVCQYF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 7 .71 RPM |
| SRP017611_kidney | 0 .00 RPM | 10 .36 RPM |
| SRP017611_liver | 0 .00 RPM | 3 .18 RPM |
| SRP040447_lung | 0 .00 RPM | 10 .26 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 3 .57 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000022770 | 1 retrocopy |
retro_cpor_775 ,
|
| Felis catus | ENSFCAG00000025918 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000014604 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000008758 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000013893 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005104 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000004430 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000016409 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000017929 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000002747 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000011829 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000000166 | 2 retrocopies |