RetrogeneDB ID: | retro_cpor_815 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_29:15983444..15983838(-) | ||
| Located in intron of: | ENSCPOG00000009240 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PIGH | ||
| Ensembl ID: | ENSCPOG00000003328 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 53.73 % |
| Parental protein coverage: | 70.21 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | GLFTLCENSTILSAAIFITVLGLLGYLHFVKIDQETLL-IIDSLGIQMTSSYASGKENTTFIEMDKVKDI |
| GL.T........S..IF.T.L..L.YLH.VK..QET...I.DS..I..TS.YASGKE.TTF.EM.KVKD. | |
| Retrocopy | GLYTIVTCTQ*ASTPIFVTLLSVLAYLHQVKTTQETVK<ITDSFVIWTTSPYASGKESTTFTEMGKVKDT |
| Parental | VIN-EAIYMQKVIYYLCILLKDPREPQKISQVVPVFQSAKPRLDCLIEVYKSCQEVLAHQKATT |
| VIN...IYMQKVI.Y...LLKDP.EP..ISQ..P.FQS.K....CL.....SCQE.L......T | |
| Retrocopy | VIN<QTIYMQKVINYF*NLLKDPVEPHSISQIAPMFQSTKTPENCLTGEGNSCQEGLIQGRHIT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 10 .30 RPM |
| SRP017611_kidney | 0 .10 RPM | 7 .33 RPM |
| SRP017611_liver | 0 .04 RPM | 1 .96 RPM |
| SRP040447_lung | 0 .00 RPM | 3 .68 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 1 .06 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000003328 | 1 retrocopy |
retro_cpor_815 ,
|
| Echinops telfairi | ENSETEG00000008623 | 1 retrocopy | |
| Homo sapiens | ENSG00000100564 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001507 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000011325 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000004467 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000739 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000005925 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000006466 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000008465 | 1 retrocopy |