RetrogeneDB ID: | retro_cpor_879 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_30:25689254..25689595(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCPOG00000013520 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 75.65 % |
Parental protein coverage: | 99.13 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MPMFILNTNVPRS-SVPDGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFAGSSEPCALCSLHSIGKIG |
.PMFILN.NVPRS.S....FLSELTQQLAQATGKP.QYI.VHV.PDQLMTF.GS..PC.LCSLHSI.KIG | |
Retrocopy | LPMFILNINVPRS<SMSERFLSELTQQLAQATGKPTQYITVHVLPDQLMTFTGSWKPCMLCSLHSIRKIG |
Parental | GAQNRSYSKLLCGLLSERLRISPDRVYINYYDMNAANVGWNSTTF |
...N.SYSKLLCGLLS..L.ISPDRVYINYYD.NAAN....S.TF | |
Retrocopy | *VLNCSYSKLLCGLLS*CLCISPDRVYINYYDINAANMSLKSSTF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 46 .19 RPM |
SRP017611_kidney | 0 .00 RPM | 85 .11 RPM |
SRP017611_liver | 0 .00 RPM | 26 .51 RPM |
SRP040447_lung | 0 .00 RPM | 45 .20 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 34 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000010668 | 3 retrocopies | |
Cavia porcellus | ENSCPOG00000013520 | 1 retrocopy |
retro_cpor_879 ,
|
Dasypus novemcinctus | ENSDNOG00000014555 | 1 retrocopy | |
Equus caballus | ENSECAG00000012792 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000012052 | 3 retrocopies | |
Mus musculus | ENSMUSG00000033307 | 8 retrocopies | |
Ochotona princeps | ENSOPRG00000012184 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000006589 | 6 retrocopies |