RetrogeneDB ID: | retro_cpor_879 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_30:25689254..25689595(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCPOG00000013520 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 75.65 % |
| Parental protein coverage: | 99.13 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | MPMFILNTNVPRS-SVPDGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFAGSSEPCALCSLHSIGKIG |
| .PMFILN.NVPRS.S....FLSELTQQLAQATGKP.QYI.VHV.PDQLMTF.GS..PC.LCSLHSI.KIG | |
| Retrocopy | LPMFILNINVPRS<SMSERFLSELTQQLAQATGKPTQYITVHVLPDQLMTFTGSWKPCMLCSLHSIRKIG |
| Parental | GAQNRSYSKLLCGLLSERLRISPDRVYINYYDMNAANVGWNSTTF |
| ...N.SYSKLLCGLLS..L.ISPDRVYINYYD.NAAN....S.TF | |
| Retrocopy | *VLNCSYSKLLCGLLS*CLCISPDRVYINYYDINAANMSLKSSTF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 46 .19 RPM |
| SRP017611_kidney | 0 .00 RPM | 85 .11 RPM |
| SRP017611_liver | 0 .00 RPM | 26 .51 RPM |
| SRP040447_lung | 0 .00 RPM | 45 .20 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 34 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000010668 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000013520 | 1 retrocopy |
retro_cpor_879 ,
|
| Dasypus novemcinctus | ENSDNOG00000014555 | 1 retrocopy | |
| Equus caballus | ENSECAG00000012792 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000012052 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000033307 | 8 retrocopies | |
| Ochotona princeps | ENSOPRG00000012184 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000006589 | 6 retrocopies |