RetrogeneDB ID: | retro_mmus_489 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 1:136789184..136789520(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Mif | ||
Ensembl ID: | ENSMUSG00000033307 | ||
Aliases: | Mif, GIF, Glif | ||
Description: | macrophage migration inhibitory factor [Source:MGI Symbol;Acc:MGI:96982] |
Percent Identity: | 91.3 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGG |
MPMFIVNTNVPR.SVPEGFLSELTQQLAQATGKPAQYIAVHV.PDQLMTF.GTNDPCALCSLHSIG...G | |
Retrocopy | MPMFIVNTNVPRTSVPEGFLSELTQQLAQATGKPAQYIAVHVLPDQLMTFRGTNDPCALCSLHSIG---G |
Parental | AQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA |
.QNRN.SKLLCGLLSDRLHISPDR.YI.YYDMNAANVGWNGSTFA | |
Retrocopy | TQNRN*SKLLCGLLSDRLHISPDRAYISYYDMNAANVGWNGSTFA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .02 RPM | 41 .24 RPM |
SRP007412_cerebellum | 0 .04 RPM | 34 .35 RPM |
SRP007412_heart | 0 .00 RPM | 28 .14 RPM |
SRP007412_kidney | 0 .02 RPM | 55 .09 RPM |
SRP007412_liver | 0 .03 RPM | 39 .71 RPM |
SRP007412_testis | 0 .00 RPM | 11 .89 RPM |
TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
---|---|---|---|---|---|---|
no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
TSS #1 | TSS_69753 | 200 libraries | 371 libraries | 434 libraries | 58 libraries | 9 libraries |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000010668 | 3 retrocopies | |
Cavia porcellus | ENSCPOG00000013520 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000014555 | 1 retrocopy | |
Equus caballus | ENSECAG00000012792 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000012052 | 3 retrocopies | |
Mus musculus | ENSMUSG00000033307 | 8 retrocopies |
retro_mmus_1573, retro_mmus_1759, retro_mmus_1878, retro_mmus_2182, retro_mmus_2444, retro_mmus_3016, retro_mmus_3315, retro_mmus_489 ,
|
Ochotona princeps | ENSOPRG00000012184 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000006589 | 6 retrocopies |