RetrogeneDB ID: | retro_cpor_98 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_1:38772468..38772684(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSCPOG00000008681 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCPOG00000008678 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 98.59 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MVPPVQVSPLIKLGRYSALVVGIAYGAKRYSYLKPRAEEERRVAEEEKKRQDELKRIERELAEAQDDSIL |
| MVPPVQVSPLIKLGRYSALVVGIAYGAKRYSYLKPRAEEERRVAEEEKKRQDELKRIERELAEA.DDSIL | |
| Retrocopy | MVPPVQVSPLIKLGRYSALVVGIAYGAKRYSYLKPRAEEERRVAEEEKKRQDELKRIERELAEARDDSIL |
| Parental | K |
| K | |
| Retrocopy | K |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .35 RPM | 39 .74 RPM |
| SRP017611_kidney | 0 .31 RPM | 85 .53 RPM |
| SRP017611_liver | 0 .04 RPM | 47 .84 RPM |
| SRP040447_lung | 0 .10 RPM | 22 .42 RPM |
| SRP040447_skeletal_muscle | 0 .47 RPM | 112 .52 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000016722 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000017496 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000023527 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000001989 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000008678 | 1 retrocopy |
retro_cpor_98 ,
|
| Felis catus | ENSFCAG00000029708 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000011414 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000050856 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000012271 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000000064 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000002962 | 1 retrocopy |