RetrogeneDB ID: | retro_rnor_697 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 10:61154900..61155114(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Atp5i | ||
Ensembl ID: | ENSRNOG00000000064 | ||
Aliases: | Atp5i, Atp5k | ||
Description: | ATP synthase subunit e, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P29419] |
Percent Identity: | 83.33 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MVPPVQVSPLIKFGRYSALILGMAYGAKRYSYLKPR-AEEERRIAAEEKKRLDELKRIERELAEAEDVSI |
MV.PVQVS.LIKFG.YSAL.LGMAYGAK.YS.LKP..A.EERRIAAEEKKRLDELKRIERELAEA.D.SI | |
Retrocopy | MVSPVQVSLLIKFGWYSALTLGMAYGAKHYS*LKPL>AGEERRIAAEEKKRLDELKRIERELAEAQDDSI |
Parental | FK |
.K | |
Retrocopy | LK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 52 .27 RPM |
SRP017611_kidney | 0 .00 RPM | 113 .61 RPM |
SRP017611_liver | 0 .00 RPM | 45 .12 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000016722 | 2 retrocopies | |
Bos taurus | ENSBTAG00000017496 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000023527 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000001989 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000008678 | 1 retrocopy | |
Felis catus | ENSFCAG00000029708 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000011414 | 1 retrocopy | |
Mus musculus | ENSMUSG00000050856 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000012271 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000000064 | 1 retrocopy |
retro_rnor_697 ,
|
Tursiops truncatus | ENSTTRG00000002962 | 1 retrocopy |