RetrogeneDB ID: | retro_rnor_697 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 10:61154900..61155114(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Atp5i | ||
| Ensembl ID: | ENSRNOG00000000064 | ||
| Aliases: | Atp5i, Atp5k | ||
| Description: | ATP synthase subunit e, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P29419] |
| Percent Identity: | 83.33 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MVPPVQVSPLIKFGRYSALILGMAYGAKRYSYLKPR-AEEERRIAAEEKKRLDELKRIERELAEAEDVSI |
| MV.PVQVS.LIKFG.YSAL.LGMAYGAK.YS.LKP..A.EERRIAAEEKKRLDELKRIERELAEA.D.SI | |
| Retrocopy | MVSPVQVSLLIKFGWYSALTLGMAYGAKHYS*LKPL>AGEERRIAAEEKKRLDELKRIERELAEAQDDSI |
| Parental | FK |
| .K | |
| Retrocopy | LK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 52 .27 RPM |
| SRP017611_kidney | 0 .00 RPM | 113 .61 RPM |
| SRP017611_liver | 0 .00 RPM | 45 .12 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000016722 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000017496 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000023527 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000001989 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000008678 | 1 retrocopy | |
| Felis catus | ENSFCAG00000029708 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000011414 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000050856 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000012271 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000000064 | 1 retrocopy |
retro_rnor_697 ,
|
| Tursiops truncatus | ENSTTRG00000002962 | 1 retrocopy |