RetrogeneDB ID: | retro_dnov_1277 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_17475:13128..13365(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ARPC5 | ||
Ensembl ID: | ENSDNOG00000010375 | ||
Aliases: | None | ||
Description: | actin related protein 2/3 complex, subunit 5, 16kDa [Source:HGNC Symbol;Acc:708] |
Percent Identity: | 54.22 % |
Parental protein coverage: | 61.94 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | VDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSVTGNMTAALQAALKNPPINTKSQAVKDRAGSIVL |
.DVDEY..N.FVD.....D.Q.G...G..D..L.....GNMT..LQAALK.P...TK.Q.V.D.AGS.V. | |
Retrocopy | MDVDEYYQNNFVDKGYLDDVQDGLNKGTMDFYLPQ---GNMTPVLQAALKKPTLTTKNQVVRD*AGSTVF |
Parental | KVLISFKANDIEK |
KV.I..KANDIEK | |
Retrocopy | KVPIN-KANDIEK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 102 .87 RPM |
SRP012922_cerebellum | 0 .00 RPM | 25 .71 RPM |
SRP012922_heart | 0 .00 RPM | 10 .91 RPM |
SRP012922_kidney | 0 .00 RPM | 21 .36 RPM |
SRP012922_liver | 0 .00 RPM | 40 .25 RPM |
SRP012922_lung | 0 .00 RPM | 71 .63 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 6 .23 RPM |
SRP012922_spleen | 0 .00 RPM | 121 .44 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000000560 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000010375 | 3 retrocopies |
retro_dnov_1277 , retro_dnov_199, retro_dnov_2495,
|
Echinops telfairi | ENSETEG00000014969 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000007194 | 1 retrocopy | |
Mus musculus | ENSMUSG00000008475 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000028062 | 1 retrocopy |