RetrogeneDB ID: | retro_dnov_1313 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_180499:528..890(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSDNOG00000007148 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 83.74 % |
Parental protein coverage: | 97.6 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | QAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNA |
.AAKRANIRLPPE.NRILYIRNL..KITAEEMY..FGKYGPI.QIRVGNTPETRGTAYVVYEDIFD.KNA | |
Retrocopy | EAAKRANIRLPPEINRILYIRNLLNKITAEEMYNTFGKYGPIHQIRVGNTPETRGTAYVVYEDIFDSKNA |
Parental | CDHLSGFN-VCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK |
.DHLS..N..CN.YL.VLY.NAN.AFQKM.T..KEEQLKLLKEKYGINTDPPK | |
Retrocopy | YDHLSIVN<LCN*YLLVLYCNANTAFQKMNT-RKEEQLKLLKEKYGINTDPPK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .19 RPM | 56 .98 RPM |
SRP012922_cerebellum | 0 .00 RPM | 48 .11 RPM |
SRP012922_heart | 0 .00 RPM | 28 .31 RPM |
SRP012922_kidney | 0 .00 RPM | 71 .46 RPM |
SRP012922_liver | 0 .00 RPM | 42 .57 RPM |
SRP012922_lung | 0 .00 RPM | 68 .88 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 24 .75 RPM |
SRP012922_spleen | 0 .00 RPM | 55 .51 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000002786 | 1 retrocopy | |
Bos taurus | ENSBTAG00000003407 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000000689 | 3 retrocopies | |
Callithrix jacchus | ENSCJAG00000007716 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000007148 | 1 retrocopy |
retro_dnov_1313 ,
|
Equus caballus | ENSECAG00000015618 | 1 retrocopy | |
Felis catus | ENSFCAG00000031365 | 1 retrocopy | |
Homo sapiens | ENSG00000115128 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000001282 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000013957 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000000815 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000004468 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000012603 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000011709 | 1 retrocopy | |
Sorex araneus | ENSSARG00000011902 | 1 retrocopy |