RetrogeneDB ID: | retro_dnov_2076 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_46025:10336..10599(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RBM3 | ||
Ensembl ID: | ENSDNOG00000010420 | ||
Aliases: | None | ||
Description: | RNA binding motif (RNP1, RRM) protein 3 [Source:HGNC Symbol;Acc:9900] |
Percent Identity: | 59.55 % |
Parental protein coverage: | 73.95 % |
Number of stop codons detected: | 5 |
Number of frameshifts detected | 1 |
Parental | GESLDGRQIRVDHAGKSARGTRGGAFGGHGRGRSYSRGGGDQGYGSSRYDSR-PGGYGYGYGRSRDYGGR |
GESLDG....VDH.GK.ARGT.G.A.GG...GRSY.RG.GD.G.GSS..DSR.P.G..YGYGRSRD.GGR | |
Retrocopy | GESLDGC*MHVDHTGKAARGTKGRALGGREHGRSYCRGVGDKG*GSSQPDSR<P*G*RYGYGRSRDNGGR |
Parental | NQGGYDRYSGGNYRDNYDN |
..G.Y...S..NYR..... | |
Retrocopy | S*GSYNCNSVRNYRNDFND |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .19 RPM | 56 .40 RPM |
SRP012922_cerebellum | 0 .00 RPM | 29 .42 RPM |
SRP012922_heart | 0 .23 RPM | 22 .28 RPM |
SRP012922_kidney | 0 .00 RPM | 38 .06 RPM |
SRP012922_liver | 0 .00 RPM | 23 .53 RPM |
SRP012922_lung | 0 .61 RPM | 50 .86 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 14 .02 RPM |
SRP012922_spleen | 0 .00 RPM | 71 .19 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000013718 | 1 retrocopy | |
Bos taurus | ENSBTAG00000025848 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000015485 | 2 retrocopies | |
Cavia porcellus | ENSCPOG00000003553 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000010420 | 16 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000017199 | 3 retrocopies | |
Gadus morhua | ENSGMOG00000012137 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000007003 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000020314 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000021591 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000027493 | 1 retrocopy |