RetrogeneDB ID: | retro_dnov_2419 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_73245:5..407(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RAB28 | ||
| Ensembl ID: | ENSDNOG00000007750 | ||
| Aliases: | None | ||
| Description: | RAB28, member RAS oncogene family [Source:HGNC Symbol;Acc:9768] |
| Percent Identity: | 85.07 % |
| Parental protein coverage: | 60.63 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | FAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQVWDIGGQTIGGKMLDKYIYGAQGILLVYDITNYQSF |
| F....FGKQYK..IGLDF.LRRITLPGNLNV.L.VWD.GGQTIGGKML.KYIYGAQG.LL.YDIT.YQSF | |
| Retrocopy | FCSRNFGKQYK*IIGLDFLLRRITLPGNLNVSL*VWDVGGQTIGGKMLGKYIYGAQGMLLAYDITHYQSF |
| Parental | ENLEDWYTVVKKVSEESETQPLVALVGNKIDLEHMRTVKPEKHLRFCQENGFSSHFVSAKTGDS |
| ENLE.WYTVVKKVSEESETQPLVALVGNKIDLEH...VKPEKHLRFC.ENGFSSHFVSAKTG.S | |
| Retrocopy | ENLEYWYTVVKKVSEESETQPLVALVGNKIDLEHK*RVKPEKHLRFCEENGFSSHFVSAKTGHS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 20 .42 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 15 .12 RPM |
| SRP012922_heart | 0 .00 RPM | 28 .31 RPM |
| SRP012922_kidney | 0 .00 RPM | 21 .63 RPM |
| SRP012922_liver | 0 .00 RPM | 13 .78 RPM |
| SRP012922_lung | 0 .00 RPM | 25 .50 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 39 .64 RPM |
| SRP012922_spleen | 0 .00 RPM | 25 .41 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000001523 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000012136 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000007750 | 4 retrocopies | |
| Dipodomys ordii | ENSDORG00000012378 | 1 retrocopy | |
| Homo sapiens | ENSG00000157869 | 7 retrocopies | |
| Gorilla gorilla | ENSGGOG00000024190 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000006792 | 4 retrocopies | |
| Macaca mulatta | ENSMMUG00000022025 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000016243 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000014610 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000015920 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000017074 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000009274 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000022358 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000004135 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000010939 | 2 retrocopies |