RetrogeneDB ID: | retro_dnov_2419 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_73245:5..407(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RAB28 | ||
Ensembl ID: | ENSDNOG00000007750 | ||
Aliases: | None | ||
Description: | RAB28, member RAS oncogene family [Source:HGNC Symbol;Acc:9768] |
Percent Identity: | 85.07 % |
Parental protein coverage: | 60.63 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 0 |
Parental | FAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQVWDIGGQTIGGKMLDKYIYGAQGILLVYDITNYQSF |
F....FGKQYK..IGLDF.LRRITLPGNLNV.L.VWD.GGQTIGGKML.KYIYGAQG.LL.YDIT.YQSF | |
Retrocopy | FCSRNFGKQYK*IIGLDFLLRRITLPGNLNVSL*VWDVGGQTIGGKMLGKYIYGAQGMLLAYDITHYQSF |
Parental | ENLEDWYTVVKKVSEESETQPLVALVGNKIDLEHMRTVKPEKHLRFCQENGFSSHFVSAKTGDS |
ENLE.WYTVVKKVSEESETQPLVALVGNKIDLEH...VKPEKHLRFC.ENGFSSHFVSAKTG.S | |
Retrocopy | ENLEYWYTVVKKVSEESETQPLVALVGNKIDLEHK*RVKPEKHLRFCEENGFSSHFVSAKTGHS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 20 .42 RPM |
SRP012922_cerebellum | 0 .00 RPM | 15 .12 RPM |
SRP012922_heart | 0 .00 RPM | 28 .31 RPM |
SRP012922_kidney | 0 .00 RPM | 21 .63 RPM |
SRP012922_liver | 0 .00 RPM | 13 .78 RPM |
SRP012922_lung | 0 .00 RPM | 25 .50 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 39 .64 RPM |
SRP012922_spleen | 0 .00 RPM | 25 .41 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000001523 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000012136 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000007750 | 4 retrocopies | |
Dipodomys ordii | ENSDORG00000012378 | 1 retrocopy | |
Homo sapiens | ENSG00000157869 | 7 retrocopies | |
Gorilla gorilla | ENSGGOG00000024190 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000006792 | 4 retrocopies | |
Macaca mulatta | ENSMMUG00000022025 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000016243 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000014610 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000015920 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000017074 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000009274 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000022358 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000004135 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000010939 | 2 retrocopies |