RetrogeneDB ID: | retro_meug_1510 | ||
Retrocopylocation | Organism: | Wallaby (Macropus eugenii) | |
Coordinates: | Scaffold43076:12686..13082(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RAB28 | ||
Ensembl ID: | ENSMEUG00000006792 | ||
Aliases: | None | ||
Description: | RAB28, member RAS oncogene family [Source:HGNC Symbol;Acc:9768] |
Percent Identity: | 71.32 % |
Parental protein coverage: | 59.73 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 4 |
Parental | LLVYDITNYQSFENLEDWYNI-VKKVNEESETQ-PLVALVGNK-IDLEHMRTVKPDKHLRFCQENGLSSH |
LLVYDITN.QSFENL........KKVNEESETQ..LV.LVGNK.ID.E.MRTVK.DKHL.FCQE.GL..H | |
Retrocopy | LLVYDITNDQSFENLG*YSMV>MKKVNEESETQ<ALVVLVGNK<IDSEPMRTVKSDKHLQFCQESGLNNH |
Parental | -FVSAKTGDSVFLCFQRVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPVSKTVNSPRSSMCTIQ |
....AKTG..VFLCF..VAAEILGI..NKAE.E.SQRVVKA...NYNQE.VSKTV..PRSSM.TIQ | |
Retrocopy | >VLGAKTGYCVFLCFH*VAAEILGIGVNKAELE*SQRVVKANTGNYNQELVSKTVHPPRSSM*TIQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000009344 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000001523 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000012136 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000007750 | 4 retrocopies | |
Dipodomys ordii | ENSDORG00000012378 | 1 retrocopy | |
Homo sapiens | ENSG00000157869 | 7 retrocopies | |
Gorilla gorilla | ENSGGOG00000024190 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000006792 | 4 retrocopies | |
Macaca mulatta | ENSMMUG00000022025 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000016243 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000014610 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000015920 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000017074 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000009274 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000022358 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000004135 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000010939 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000003622 | 1 retrocopy |