RetrogeneDB ID: | retro_dord_682 | ||
Retrocopy location | Organism: | Kangaroo rat (Dipodomys ordii) | |
| Coordinates: | scaffold_53397:2452..2796(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Rab28 | ||
| Ensembl ID: | ENSDORG00000012378 | ||
| Aliases: | None | ||
| Description: | RAB28, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1917285] |
| Percent Identity: | 57.02 % |
| Parental protein coverage: | 59.69 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 4 |
| Parental | SLATCFAQETFGKQYKQTIGLDFFMRRITLQGNLNVTLQVWDIGGQTIGGKMLDKYIYG-AQGILLVYDI |
| SL...FAQ.T...QY..T..L.F..RR.TL..NLNV..QV..I.G.T.GGK.L.KY.YG.A.G.LL...I | |
| Retrocopy | SLDIDFAQDTLENQYQPTVRLEFSLRRLTLTENLNVAFQVCKIRG*TAGGKLLEKYTYG<ALGTLLMGEI |
| Parental | TNYQSFENLEDWYTVV-KKVSEESE-THPLVALVGNKIDLEHMR-TVKPEK |
| .N.QSFEN.EDW.T.V.KKVSE..E.T.PL.ALVG..I.LEH....VKPE. | |
| Retrocopy | -NHQSFEN*EDWHTLV<KKVSETLE<TQPLAALVGKQIYLEHSK<RVKPER |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009344 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000001523 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000012136 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000007750 | 4 retrocopies | |
| Dipodomys ordii | ENSDORG00000012378 | 1 retrocopy |
retro_dord_682 ,
|
| Homo sapiens | ENSG00000157869 | 7 retrocopies | |
| Gorilla gorilla | ENSGGOG00000024190 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000006792 | 4 retrocopies | |
| Macaca mulatta | ENSMMUG00000022025 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000016243 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000014610 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000015920 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000017074 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000009274 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000022358 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000004135 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000010939 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000003622 | 1 retrocopy |