RetrogeneDB ID: | retro_dnov_2474 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_78513:4914..5126(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | BOLA3 | ||
Ensembl ID: | ENSDNOG00000008309 | ||
Aliases: | None | ||
Description: | bolA homolog 3 (E. coli) [Source:HGNC Symbol;Acc:24415] |
Percent Identity: | 68.06 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MAAWGPAAAAPLLRGIRGLPLLHSGHRMFASQTEGELKVTQILKEKFPRATT-IKVTDISEGCGAMYEIK |
.A..GPA.A.PLL.G..G.PLL.S.H.MFA.QTE.ELKVTQILKEKFP.AT...KV.D.S.GCG.MYEIK | |
Retrocopy | IAFLGPAKASPLLCGNFGHPLLPSRH*MFACQTESELKVTQILKEKFPGATS<FKVNDNSGGCGVMYEIK |
Parental | IE |
I. | |
Retrocopy | IK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .39 RPM | 4 .47 RPM |
SRP012922_cerebellum | 0 .96 RPM | 1 .24 RPM |
SRP012922_heart | 0 .00 RPM | 5 .80 RPM |
SRP012922_kidney | 0 .27 RPM | 1 .92 RPM |
SRP012922_liver | 0 .46 RPM | 2 .63 RPM |
SRP012922_lung | 2 .29 RPM | 2 .44 RPM |
SRP012922_quadricep_muscle | 0 .52 RPM | 2 .42 RPM |
SRP012922_spleen | 0 .69 RPM | 3 .09 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000008739 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000017844 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000008309 | 2 retrocopies |
retro_dnov_2474 , retro_dnov_510,
|
Myotis lucifugus | ENSMLUG00000016364 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000007813 | 1 retrocopy | |
Mus musculus | ENSMUSG00000045160 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000016658 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000003502 | 1 retrocopy | |
Sorex araneus | ENSSARG00000001754 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000008291 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000006698 | 3 retrocopies |