RetrogeneDB ID: | retro_dnov_764 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_10549:71058..71238(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDUFA4 | ||
Ensembl ID: | ENSDNOG00000011217 | ||
Aliases: | None | ||
Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa [Source:HGNC Symbol;Acc:7687] |
Percent Identity: | 67.19 % |
Parental protein coverage: | 76.83 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | VFIGTGATGAALYVLRLAMFNPDVSW-DRKNNPEPWNKLGPNEQYKFYSVNVDYSKLKKEGPEF |
VF.G.....AAL..L.L..FNPDVS...RKNNPE....LGPNEQY.FYSVN.DYSKLKKEGP.F | |
Retrocopy | VFSGVRGSCAALDALHLVVFNPDVSCCGRKNNPE----LGPNEQYNFYSVNTDYSKLKKEGPDF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 170 .55 RPM |
SRP012922_cerebellum | 0 .00 RPM | 318 .52 RPM |
SRP012922_heart | 0 .00 RPM | 1647 .89 RPM |
SRP012922_kidney | 0 .00 RPM | 501 .32 RPM |
SRP012922_liver | 0 .00 RPM | 245 .68 RPM |
SRP012922_lung | 0 .00 RPM | 179 .76 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 1072 .95 RPM |
SRP012922_spleen | 0 .00 RPM | 157 .61 RPM |