RetrogeneDB ID: | retro_ecab_1106 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | X:41758959..41759316(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PSMA5 | ||
Ensembl ID: | ENSECAG00000011835 | ||
Aliases: | None | ||
Description: | proteasome (prosome, macropain) subunit, alpha type, 5 [Source:HGNC Symbol;Acc:9534] |
Percent Identity: | 50.41 % |
Parental protein coverage: | 50.21 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 0 |
Parental | NTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSGLI |
N..S...RLF...Y.I..IKL.S.AIGIQTSE.VC....K.....L..P.S.EK.V.IDA...C..S.L. | |
Retrocopy | NLLSLFPRLFHE*YVIGMIKLCSIAIGIQTSE-VCVPSYKE-ENYLLLPCSSEKVVDIDAQTSCVESNLM |
Parental | ADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAM |
A.AKT.IDKARVET....FTY......E......SNL..QFGEE..DP.A. | |
Retrocopy | AGAKTIIDKARVETSDLCFTYKKINDIEE*S*FESNLNVQFGEENTDPEAI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 10 .68 RPM |
SRP021940_cerebellum | 0 .00 RPM | 20 .67 RPM |
SRP021940_embryo | 0 .00 RPM | 28 .10 RPM |
SRP021940_placental_villous | 0 .00 RPM | 28 .82 RPM |
SRP021940_synovial_membrane | 0 .00 RPM | 18 .50 RPM |
SRP021940_testis | 0 .00 RPM | 34 .02 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Cavia porcellus | ENSCPOG00000013670 | 1 retrocopy | |
Equus caballus | ENSECAG00000011835 | 1 retrocopy |
retro_ecab_1106 ,
|
Echinops telfairi | ENSETEG00000012916 | 1 retrocopy | |
Mus musculus | ENSMUSG00000068749 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000008863 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000019868 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000006830 | 2 retrocopies |