RetrogeneDB ID: | retro_ecab_384 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 16:52947060..52947430(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C2orf76 | ||
Ensembl ID: | ENSECAG00000002063 | ||
Aliases: | None | ||
Description: | chromosome 2 open reading frame 76 [Source:HGNC Symbol;Acc:27017] |
Percent Identity: | 70.31 % |
Parental protein coverage: | 99.2 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 4 |
Parental | ASEVTVTVRL-IRSFEHRNFRPVVYHGVNLDQTVKEFIVFLKQDIPLRT-SLPPPFRNYKYDKLKIIHQA |
..EVT.T..L..RS.EHRNF..V.YHGVNLD.T.K.FIVFLKQD..LR...LPPPF.NYKYDKLKIIHQA | |
Retrocopy | SEEVTTTGHL<LRSVEHRNFKSVIYHGVNLDETAKGFIVFLKQDVSLRS<NLPPPFGNYKYDKLKIIHQA |
Parental | HKSKTNELVLSLEDDD-RLLLKEDGTLQAAGIANETEI-AFFCEEDYKNFKANPVSSW |
HKSKTNELVLSL..D...L.L.E...L.AAGIAN.TEI..F.CEEDY.N.KANP.SSW | |
Retrocopy | HKSKTNELVLSLGNDG>QLPL*ENSALKAAGIANDTEI<SFSCEEDYTNYKANPISSW |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 0 .30 RPM |
SRP021940_cerebellum | 0 .00 RPM | 0 .62 RPM |
SRP021940_embryo | 0 .00 RPM | 1 .38 RPM |
SRP021940_placental_villous | 0 .00 RPM | 0 .29 RPM |
SRP021940_synovial_membrane | 0 .00 RPM | 0 .38 RPM |
SRP021940_testis | 0 .00 RPM | 3 .07 RPM |
Species | RetrogeneDB ID |
---|---|
Bos taurus | retro_btau_965 |
Canis familiaris | retro_cfam_1119 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000008507 | 2 retrocopies | |
Bos taurus | ENSBTAG00000010599 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000004896 | 2 retrocopies | |
Equus caballus | ENSECAG00000002063 | 1 retrocopy |
retro_ecab_384 ,
|
Myotis lucifugus | ENSMLUG00000004031 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000000943 | 1 retrocopy | |
Mus musculus | ENSMUSG00000026388 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000011615 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000015718 | 1 retrocopy |