RetrogeneDB ID: | retro_sscr_311 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
Coordinates: | 13:19161481..19161733(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C2orf76 | ||
Ensembl ID: | ENSSSCG00000015718 | ||
Aliases: | None | ||
Description: | chromosome 2 open reading frame 76 [Source:HGNC Symbol;Acc:27017] |
Percent Identity: | 64.44 % |
Parental protein coverage: | 63.5 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 3 |
Parental | VFLKQDIPLKTSLPPPFRNYEYDKLKI-VHQAHKSKTNELVLSLEDDDKLLLKEDSTLKAAGIANETEIA |
VFLK.D.PL.TSLPPP.RNY.Y.KLKI...QAH..KTNELVL...D...L.LKEDS.........ETE.A | |
Retrocopy | VFLKLDAPLRTSLPPPLRNYKYEKLKI<IPQAHTPKTNELVLRFKDSNRLSLKEDSS-QSSWNHDETETA |
Parental | -FFCEEDYK-NYKANPISSW |
..FC.EDYK.NYKANPISSW | |
Retrocopy | <IFC-EDYK<NYKANPISSW |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP014902_placenta | 0 .00 RPM | 0 .93 RPM |
SRP014902_testis | 0 .00 RPM | 3 .68 RPM |
SRP018288_heart | 0 .00 RPM | 1 .96 RPM |
SRP018288_kidney | 0 .00 RPM | 4 .14 RPM |
SRP018288_liver | 0 .00 RPM | 3 .68 RPM |
SRP018288_lung | 0 .00 RPM | 2 .95 RPM |
SRP018856_adipose | 0 .00 RPM | 4 .08 RPM |
SRP035408_brain | 0 .00 RPM | 2 .73 RPM |
SRP035408_liver | 0 .00 RPM | 3 .05 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000008507 | 2 retrocopies | |
Bos taurus | ENSBTAG00000010599 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000004896 | 2 retrocopies | |
Equus caballus | ENSECAG00000002063 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000004031 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000000943 | 1 retrocopy | |
Mus musculus | ENSMUSG00000026388 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000011615 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000015718 | 1 retrocopy |
retro_sscr_311 ,
|