RetrogeneDB ID: | retro_ecab_525 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 2:101381817..101382114(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TAF10 | ||
Ensembl ID: | ENSECAG00000007794 | ||
Aliases: | None | ||
Description: | TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa [Source:HGNC Symbol;Acc:11543] |
Percent Identity: | 66.67 % |
Parental protein coverage: | 98.98 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | QLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIAN--DALQHCKMKGTASGSSRSKSK |
QLED.TPTIPD.VTGY.LN.AGF.ASDP.I...I.L.AQKFISDIAN..D.L.HCK.KGTAS.SS.SK.. | |
Retrocopy | QLEDCTPTIPDRVTGYSLNHAGFGASDPDITQFIPLTAQKFISDIANNVDVLWHCKRKGTASSSS*SKKR |
Parental | DRKYTLTMEDLTPALSEYGINVKKPHYFT |
D..YTL..EDLT..LS.Y.I...KP..FT | |
Retrocopy | DHRYTLSIEDLTSTLSKYDISINKPQHFT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 19 .48 RPM |
SRP021940_cerebellum | 0 .00 RPM | 26 .33 RPM |
SRP021940_embryo | 0 .00 RPM | 28 .08 RPM |
SRP021940_placental_villous | 0 .00 RPM | 25 .16 RPM |
SRP021940_synovial_membrane | 0 .00 RPM | 27 .01 RPM |
SRP021940_testis | 0 .00 RPM | 69 .38 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000016278 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000006498 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000000814 | 1 retrocopy | |
Equus caballus | ENSECAG00000007794 | 1 retrocopy |
retro_ecab_525 ,
|
Erinaceus europaeus | ENSEEUG00000008412 | 3 retrocopies | |
Echinops telfairi | ENSETEG00000008886 | 1 retrocopy | |
Felis catus | ENSFCAG00000015390 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000029330 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000008216 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000024459 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000007743 | 1 retrocopy | |
Mus musculus | ENSMUSG00000043866 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000004894 | 1 retrocopy |