RetrogeneDB ID: | retro_ecab_579 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 21:35070581..35070857(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CDK2AP2 | ||
Ensembl ID: | ENSECAG00000020079 | ||
Aliases: | None | ||
Description: | cyclin-dependent kinase 2 associated protein 2 [Source:HGNC Symbol;Acc:30833] |
Percent Identity: | 52.63 % |
Parental protein coverage: | 73.81 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MSYKPIAPAPSSTPGSST--PGPGTPVPTGSVPSPSGSVPGAAAPFRPLFNDFGPPSMGYVQAMKPPGAQ |
MSYK.IAP..SS.P......P.P..P.P..S......SVPG..A.F.P.F.DFGPPS.GYVQ..K.P..Q | |
Retrocopy | MSYKSIAPNLSSSPSPAPLGPAPCSP*PLVSHRHQWDSVPGGTACFGPVFKDFGPPSLGYVQVTKTPSIQ |
Parental | GSQSTYTDLLSVIEEMGKEIRPTYA |
.SQ.TY.DLL....E.GKE..P.YA | |
Retrocopy | DSQGTYRDLL---WETGKELWPAYA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 8 .32 RPM |
SRP021940_cerebellum | 0 .00 RPM | 18 .75 RPM |
SRP021940_embryo | 0 .00 RPM | 14 .63 RPM |
SRP021940_placental_villous | 0 .00 RPM | 28 .72 RPM |
SRP021940_synovial_membrane | 0 .00 RPM | 22 .10 RPM |
SRP021940_testis | 0 .00 RPM | 12 .34 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000011370 | 1 retrocopy | |
Equus caballus | ENSECAG00000020079 | 2 retrocopies |
retro_ecab_180, retro_ecab_579 ,
|
Echinops telfairi | ENSETEG00000006428 | 3 retrocopies | |
Homo sapiens | ENSG00000167797 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000010159 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000011827 | 5 retrocopies | |
Nomascus leucogenys | ENSNLEG00000006438 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000008275 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000003966 | 9 retrocopies | |
Tupaia belangeri | ENSTBEG00000005476 | 2 retrocopies |