RetrogeneDB ID: | retro_ecab_752 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 30:23478608..23478790(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FKBP1B | ||
Ensembl ID: | ENSECAG00000015664 | ||
Aliases: | None | ||
Description: | FK506 binding protein 1B, 12.6 kDa [Source:HGNC Symbol;Acc:3712] |
Percent Identity: | 65.08 % |
Parental protein coverage: | 64.58 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | TFPKKGQTCVVH-YTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLT |
TF.K..QTCVVH.Y..MLQ.GKKFDSS.D.NK..KF..GKQEVI....EG..QM..GQRAKL. | |
Retrocopy | TFAKLHQTCVVH<YSRMLQDGKKFDSSQDGNKTIKFMVGKQEVIR-V*EGVTQMRMGQRAKLS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 1 .24 RPM |
SRP021940_cerebellum | 0 .00 RPM | 22 .38 RPM |
SRP021940_embryo | 0 .00 RPM | 10 .51 RPM |
SRP021940_placental_villous | 0 .00 RPM | 0 .67 RPM |
SRP021940_synovial_membrane | 0 .00 RPM | 2 .09 RPM |
SRP021940_testis | 0 .00 RPM | 1 .02 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000007700 | 1 retrocopy | |
Ciona savignyi | ENSCSAVG00000006859 | 1 retrocopy | |
Equus caballus | ENSECAG00000015664 | 1 retrocopy |
retro_ecab_752 ,
|
Equus caballus | ENSECAG00000018299 | 2 retrocopies | |
Homo sapiens | ENSG00000119782 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000010689 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000012341 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000000800 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000012604 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000011708 | 1 retrocopy |