RetrogeneDB ID: | retro_ecab_903 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 6:45624440..45624787(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ZMYND19 | ||
Ensembl ID: | ENSECAG00000012412 | ||
Aliases: | None | ||
Description: | zinc finger, MYND-type containing 19 [Source:HGNC Symbol;Acc:21146] |
Percent Identity: | 60.98 % |
Parental protein coverage: | 57.82 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 1 |
Parental | GGIAPGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQFPVLNVT |
GG.A.G.Q...L........LDN.QLV..GW.PKAEETS.KQREQSLYWL.I.QLP..P.E.QFP....T | |
Retrocopy | GGAA*GRQCWGLSG-GASQHLDNMQLVRRGWGPKAEETSRKQREQSLYWLVIHQLPMGPTEGQFP----T |
Parental | RYYNANGDVVEEEENSCTY-YECHYPPCTMIEKQLREFNICGRCQVARYCGSQ |
.YYNAN.DVV..EENSCTY...CHY.P.T..E..LR.FNICGRC..A...GSQ | |
Retrocopy | WYYNANRDVV-GEENSCTY<QQCHYAP*TVTEM*LRVFNICGRC*MAWSWGSQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 6 .97 RPM |
SRP021940_cerebellum | 0 .00 RPM | 17 .71 RPM |
SRP021940_embryo | 0 .00 RPM | 25 .67 RPM |
SRP021940_placental_villous | 0 .00 RPM | 9 .19 RPM |
SRP021940_synovial_membrane | 0 .00 RPM | 12 .08 RPM |
SRP021940_testis | 0 .00 RPM | 72 .96 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dasypus novemcinctus | ENSDNOG00000006644 | 2 retrocopies | |
Dipodomys ordii | ENSDORG00000008360 | 1 retrocopy | |
Equus caballus | ENSECAG00000012412 | 1 retrocopy |
retro_ecab_903 ,
|
Echinops telfairi | ENSETEG00000005023 | 1 retrocopy | |
Homo sapiens | ENSG00000165724 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000006875 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000011727 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000019610 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000017172 | 1 retrocopy | |
Mus musculus | ENSMUSG00000026974 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000009236 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000010812 | 1 retrocopy |