RetrogeneDB ID: | retro_eeur_103 | ||
Retrocopylocation | Organism: | Hedgehog (Erinaceus europaeus) | |
Coordinates: | GeneScaffold_6308:28526..28856(+) | ||
Located in intron of: | ENSEEUG00000004076 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TFAM | ||
Ensembl ID: | ENSEEUG00000006119 | ||
Aliases: | None | ||
Description: | transcription factor A, mitochondrial [Source:HGNC Symbol;Acc:11741] |
Percent Identity: | 68.18 % |
Parental protein coverage: | 76.92 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | VYEDAYKADWESYKEEMNRLQKNLTPSQIESLEKEVLQKRLKKKAIIKKRELTMLGKPKRPRTAHNIFVS |
VYE.AY.ADWESYKEE...LQK.LTP.QIESLEKEVLQK..KKKAIIKKRELTMLGKPKRP.TA.NIF.. | |
Retrocopy | VYEGAYRADWESYKEELSKLQKHLTPTQIESLEKEVLQKCFKKKAIIKKRELTMLGKPKRPHTAYNIFIA |
Parental | ERFQEAKDLSVQXXXXXXXXXXXXXXXXXXXAYIQLAEDD |
ERFQE.KDLS.Q....................YIQLAEDD | |
Retrocopy | ERFQETKDLSAQGRLRSVNKSWKNLTSSQKQVYIQLAEDD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .48 RPM | 6 .28 RPM |
SRP017611_kidney | 0 .19 RPM | 12 .57 RPM |
SRP017611_liver | 0 .64 RPM | 11 .90 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dasypus novemcinctus | ENSDNOG00000000535 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000014013 | 2 retrocopies | |
Erinaceus europaeus | ENSEEUG00000006119 | 3 retrocopies |
retro_eeur_103 , retro_eeur_182, retro_eeur_652,
|
Homo sapiens | ENSG00000108064 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000004948 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000012891 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000008802 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000019829 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000012295 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000014405 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000002430 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000002519 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000000613 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000009246 | 1 retrocopy |