RetrogeneDB ID: | retro_eeur_211 | ||
Retrocopylocation | Organism: | Hedgehog (Erinaceus europaeus) | |
Coordinates: | scaffold_209704:4331..4629(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CNEP1R1 | ||
Ensembl ID: | ENSEEUG00000005737 | ||
Aliases: | None | ||
Description: | CTD nuclear envelope phosphatase 1 regulatory subunit 1 [Source:HGNC Symbol;Acc:26759] |
Percent Identity: | 75.73 % |
Parental protein coverage: | 98.02 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | MNSLEQAEDLKAFERRLTEYIH--CLQPATGRWR-MLLIVVSVCTATGAWNWLIDPETQKVSFLTSLWNH |
MNSLEQAEDLKAF.RR.TEYI...C..P...R.R..L..V.SV.TAT.AW.WLIDPETQKVSFLTSL.NH | |
Retrocopy | MNSLEQAEDLKAFNRRFTEYIFIVCNLPLGIRER<LLIVV-SVSTATEAWKWLIDPETQKVSFLTSL*NH |
Parental | PFFTISCITLIGLFFAGIHKR-VVAPSMYPLLR |
P.FTISCITLI.LFFA.IHKR..VAPSMYPLLR | |
Retrocopy | PLFTISCITLIRLFFAVIHKR<IVAPSMYPLLR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .16 RPM | 5 .00 RPM |
SRP017611_kidney | 0 .00 RPM | 11 .81 RPM |
SRP017611_liver | 0 .00 RPM | 4 .34 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000006491 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000001997 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000012791 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000005737 | 1 retrocopy |
retro_eeur_211 ,
|
Felis catus | ENSFCAG00000023936 | 1 retrocopy | |
Homo sapiens | ENSG00000205423 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000025211 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000012573 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000006900 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000008365 | 3 retrocopies | |
Mustela putorius furo | ENSMPUG00000003109 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000000727 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000005923 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000015665 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000007335 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000041682 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000001179 | 1 retrocopy |