RetrogeneDB ID: | retro_pabe_2430 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 4:39745918..39746220(+) | ||
Located in intron of: | ENSPPYG00000014666 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CNEP1R1 | ||
Ensembl ID: | ENSPPYG00000007335 | ||
Aliases: | CNEP1R1, TMEM188 | ||
Description: | Nuclear envelope phosphatase-regulatory subunit 1 [Source:UniProtKB/Swiss-Prot;Acc:Q5R7J7] |
Percent Identity: | 51.82 % |
Parental protein coverage: | 84.8 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 3 |
Parental | YIHCLQPATGRWRMLLIVVSVCTATG-AWNWLI-DPETQKVSFFTSLWNHPFFTISCITLIGLFF-AGIH |
.I.CL......W...L.....CTA...A.NWLI.DP.TQK..F..SL.NH.FFT..C....GLF..AGIH | |
Retrocopy | HIFCLWSTVRHWTTILRTMFICTAAR<AGNWLIRDPKTQK-RFHPSL*NHLFFTGCC----GLFL<AGIH |
Parental | KRVVAPSIIAARCRTVLAEYNMSCDDTGK-LILKPRPHVQ |
KRVVAP.I.AA....V.A.YN..C.D.GK..ILK.RP.V. | |
Retrocopy | KRVVAPLI*AAWYQIVFADYNTPC-DVGK>IILKSRPYVE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 5 .20 RPM |
SRP007412_cerebellum | 0 .00 RPM | 11 .07 RPM |
SRP007412_heart | 0 .03 RPM | 4 .30 RPM |
SRP007412_kidney | 0 .10 RPM | 3 .55 RPM |
SRP007412_liver | 0 .03 RPM | 2 .91 RPM |
Species | RetrogeneDB ID |
---|---|
Macaca mulatta | retro_mmul_1873 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000006491 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000001997 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000012791 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000005737 | 1 retrocopy | |
Felis catus | ENSFCAG00000023936 | 1 retrocopy | |
Homo sapiens | ENSG00000205423 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000025211 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000012573 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000006900 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000008365 | 3 retrocopies | |
Mustela putorius furo | ENSMPUG00000003109 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000000727 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000005923 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000015665 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000007335 | 3 retrocopies |
retro_pabe_1396, retro_pabe_2430 , retro_pabe_3799,
|
Pan troglodytes | ENSPTRG00000041682 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000001179 | 1 retrocopy |