RetrogeneDB ID: | retro_cjac_4204 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | X:92393529..92393885(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CNEP1R1 | ||
| Ensembl ID: | ENSCJAG00000001997 | ||
| Aliases: | None | ||
| Description: | CTD nuclear envelope phosphatase 1 regulatory subunit 1 [Source:HGNC Symbol;Acc:26759] |
| Percent Identity: | 75.0 % |
| Parental protein coverage: | 83.1 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | QDLKAFERRLTEYIHC-LQPATGRWRMLLIVVSVCTATGAWNWLIDPETQKVS-FFTSLWNHPFFTISCI |
| ..LK.FERR.TEYIH..LQP.T..W.M.L.VVSV.TATG.WN.LIDP.TQKVS.FF.SLWNHPFF.I.CI | |
| Retrocopy | EELKGFERRITEYIHF>LQPTTEHWKMFLTVVSVRTATGTWNCLIDPDTQKVS>FFPSLWNHPFFIINCI |
| Parental | TLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKPRPHVQ |
| TLIG.FFAGIHK.VVAPSII.A.C.T.LAEYN.SC.D.GKLILK.RPHVQ | |
| Retrocopy | TLIG*FFAGIHKTVVAPSIITAQCQTALAEYNTSCNDAGKLILKCRPHVQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 5 .84 RPM |
| SRP051959_heart | 0 .00 RPM | 4 .68 RPM |
| SRP051959_kidney | 0 .00 RPM | 6 .59 RPM |
| SRP051959_liver | 0 .00 RPM | 3 .81 RPM |
| SRP051959_lung | 0 .00 RPM | 6 .33 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 7 .28 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 4 .87 RPM |
| SRP051959_spleen | 0 .00 RPM | 6 .20 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4886 |
| Pan troglodytes | retro_ptro_3255 |
| Gorilla gorilla | retro_ggor_3051 |
| Pongo abelii | retro_pabe_3799 |
| Macaca mulatta | retro_mmul_2624 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006491 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000001997 | 1 retrocopy |
retro_cjac_4204 ,
|
| Cavia porcellus | ENSCPOG00000012791 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000005737 | 1 retrocopy | |
| Felis catus | ENSFCAG00000023936 | 1 retrocopy | |
| Homo sapiens | ENSG00000205423 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000025211 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000012573 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000006900 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000008365 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000003109 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000727 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000005923 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000015665 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000007335 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000041682 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000001179 | 1 retrocopy |