RetrogeneDB ID: | retro_eeur_249 | ||
Retrocopylocation | Organism: | Hedgehog (Erinaceus europaeus) | |
Coordinates: | scaffold_222934:4009..4327(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBE2C | ||
Ensembl ID: | ENSEEUG00000010643 | ||
Aliases: | None | ||
Description: | ubiquitin-conjugating enzyme E2C [Source:HGNC Symbol;Acc:15937] |
Percent Identity: | 66.04 % |
Parental protein coverage: | 59.22 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | YEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKDKWSALYDVRTILLSIQSLLGEPN |
YE.L.YKLSL.F..GYPY.APTV.FLT..YHPN.DT.GNICLDIL...WSALYDV.T.LLSIQSLL.EP. | |
Retrocopy | YEGLSYKLSLHFHRGYPYEAPTVRFLTASYHPNLDTRGNICLDILQEHWSALYDVWTQLLSIQSLLAEPS |
Parental | IDSPLNTHAAELWKNPTAFKKYLQETYSKQVASQEP |
..S.LNT.AA.LW....AF...L.ETYS.....QEP | |
Retrocopy | LHSLLNTQAA*LWGSLYAFRNHLLETYSEKLSIQEP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 0 .32 RPM |
SRP017611_kidney | 0 .00 RPM | 0 .19 RPM |
SRP017611_liver | 0 .00 RPM | 0 .16 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000016746 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000009745 | 6 retrocopies | |
Equus caballus | ENSECAG00000014619 | 2 retrocopies | |
Erinaceus europaeus | ENSEEUG00000010643 | 14 retrocopies | |
Erinaceus europaeus | ENSEEUG00000011886 | 1 retrocopy | |
Felis catus | ENSFCAG00000001885 | 4 retrocopies | |
Loxodonta africana | ENSLAFG00000003164 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000007177 | 14 retrocopies | |
Microcebus murinus | ENSMICG00000011218 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000021023 | 4 retrocopies | |
Monodelphis domestica | ENSMODG00000013661 | 6 retrocopies | |
Mustela putorius furo | ENSMPUG00000017619 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000012176 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000004989 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000013564 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000007423 | 1 retrocopy |