RetrogeneDB ID: | retro_eeur_45 | ||
Retrocopylocation | Organism: | Hedgehog (Erinaceus europaeus) | |
Coordinates: | GeneScaffold_2581:62105..62317(+) | ||
Located in intron of: | ENSEEUG00000003394 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MAGOH | ||
Ensembl ID: | ENSEEUG00000015908 | ||
Aliases: | None | ||
Description: | mago-nashi homolog, proliferation-associated (Drosophila) [Source:HGNC Symbol;Acc:6815] |
Percent Identity: | 73.61 % |
Parental protein coverage: | 81.4 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 1 |
Parental | ESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIR-KEAYVHKSVMEE-LKRIIDDSEI |
ESDFYL.YYVGHKG.FGHEFLEFE..P.GKLRYANNSNYK.D.M...KEAY.HK......L.RIIDDSEI | |
Retrocopy | ESDFYLHYYVGHKGNFGHEFLEFEL*PNGKLRYANNSNYKKDAMNG<KEAYAHKMCRRS*L*RIIDDSEI |
Parental | TK |
T. | |
Retrocopy | TR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .16 RPM | 1 .13 RPM |
SRP017611_kidney | 0 .00 RPM | 6 .00 RPM |
SRP017611_liver | 0 .00 RPM | 1 .61 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000009587 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000015908 | 6 retrocopies | |
Felis catus | ENSFCAG00000025232 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000012778 | 1 retrocopy | |
Sorex araneus | ENSSARG00000012081 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000003849 | 3 retrocopies |