RetrogeneDB ID: | retro_etel_1629 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
Coordinates: | scaffold_284063:3626..3870(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PFDN1 | ||
Ensembl ID: | ENSETEG00000019281 | ||
Aliases: | None | ||
Description: | prefoldin subunit 1 [Source:HGNC Symbol;Acc:8866] |
Percent Identity: | 67.86 % |
Parental protein coverage: | 67.21 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | SRTRKHAHLTDTEIMTLVDETHMYEGVGRMFILQSKEVIHNQLLEKQKIAEEKIKELEQKKSYL-ERSVK |
....KHAH...TE.MT.VDET.M.EG.GR.F.LQ.K.VIHNQLLEKQK...EKIKELE.KK..L.E.SVK | |
Retrocopy | AKLKKHAHFAATEAMTMVDETNMSEGTGRTFLLQAKKVIHNQLLEKQK*QREKIKELEHKKFCL<EQSVK |
Parental | EAEDNIR-EMLMAR |
E.E.NIR.EMLMAR | |
Retrocopy | EVEENIR<EMLMAR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000005742 | 8 retrocopies | |
Equus caballus | ENSECAG00000011843 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000005357 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000019281 | 1 retrocopy |
retro_etel_1629 ,
|
Felis catus | ENSFCAG00000001272 | 1 retrocopy | |
Homo sapiens | ENSG00000113068 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000002726 | 3 retrocopies | |
Microcebus murinus | ENSMICG00000000349 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000009432 | 4 retrocopies | |
Otolemur garnettii | ENSOGAG00000003376 | 6 retrocopies | |
Pan troglodytes | ENSPTRG00000017310 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000018653 | 1 retrocopy |