RetrogeneDB ID: | retro_etel_929 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
Coordinates: | scaffold_18555:551..980(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SPIC | ||
Ensembl ID: | ENSETEG00000004217 | ||
Aliases: | None | ||
Description: | Spi-C transcription factor (Spi-1/PU.1 related) [Source:HGNC Symbol;Acc:29549] |
Percent Identity: | 65.03 % |
Parental protein coverage: | 62.72 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | NLQCAPDYKNYLAFINHCAQVQGSPSCLGVLPAEEPACTWKAIINNVADYCVEANIHPSLQNVAENQLMQ |
NL....DYKNYLAFINHCAQV.G.PSC.GVLPAEEPACTWK.IINNVAD.CVEANIHPSLQN..ENQLM. | |
Retrocopy | NLLIKHDYKNYLAFINHCAQVRGNPSCFGVLPAEEPACTWKTIINNVADCCVEANIHPSLQNITENQLMK |
Parental | PAALQQKVGKXXXXXXXXXXXXXSLCNPEMASCISWVDRSKGIFQFMSKNKEILARALQNYGGTGETIKI |
PAALQ...GK.............SLCNPEM.SCI.WVDRS..IFQF.S.NKE.LA.......G...T... | |
Retrocopy | PAALQKNGGKGRKKL*LFEYLLESLCNPEMTSCIQWVDRSTDIFQFVSENKERLAELWGERQGNQKTMTY |
Parental | WKL |
.K. | |
Retrocopy | QKM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000009904 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000001906 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000004496 | 1 retrocopy | |
Equus caballus | ENSECAG00000009614 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000004217 | 6 retrocopies | |
Homo sapiens | ENSG00000166211 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000024597 | 4 retrocopies | |
Loxodonta africana | ENSLAFG00000015661 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000011052 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000020873 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000006232 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000008070 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000015148 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000004873 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000005351 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000005720 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000015457 | 3 retrocopies | |
Tursiops truncatus | ENSTTRG00000017205 | 1 retrocopy |