RetrogeneDB ID: | retro_pabe_1445 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 17:29944173..29944602(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SPIC | ||
Ensembl ID: | ENSPPYG00000004873 | ||
Aliases: | None | ||
Description: | Spi-C transcription factor (Spi-1/PU.1 related) [Source:HGNC Symbol;Acc:29549] |
Percent Identity: | 88.81 % |
Parental protein coverage: | 57.66 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MTCVEQDKLGQAFEDAFEVLRQHSTGDLQYSPDYRNYLALINHRPHVKGNSSCYGVLPTEEPVYNWRTVI |
M.CVEQDKLGQ.FEDAF.VLRQHSTGDL.YSPDY.NYLALIN..PHVKGNSSCYGVLPTEEP.YNWR.VI | |
Retrocopy | MMCVEQDKLGQTFEDAFDVLRQHSTGDL*YSPDYKNYLALINNCPHVKGNSSCYGVLPTEEPLYNWRMVI |
Parental | NSAADFYFEGNIHQSLQNITENQLVQPTVLQQKGGKGRKKLRLFEYLHESLYNPEMASCIQWVDKTKGIF |
NSAADFYFEGNIHQSLQNITENQLVQPT.LQQK.G..RKKLRLFEYLHESL.NPEMA.CIQWVDKTKGIF | |
Retrocopy | NSAADFYFEGNIHQSLQNITENQLVQPTILQQKRGRDRKKLRLFEYLHESLCNPEMALCIQWVDKTKGIF |
Parental | QFV |
.FV | |
Retrocopy | PFV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .03 RPM |
SRP007412_liver | 0 .00 RPM | 0 .83 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000009904 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000001906 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000004496 | 1 retrocopy | |
Equus caballus | ENSECAG00000009614 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000004217 | 6 retrocopies | |
Homo sapiens | ENSG00000166211 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000024597 | 4 retrocopies | |
Loxodonta africana | ENSLAFG00000015661 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000011052 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000020873 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000008070 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000015148 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000004873 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000005351 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000005720 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000015457 | 3 retrocopies | |
Tursiops truncatus | ENSTTRG00000017205 | 1 retrocopy |