RetrogeneDB ID: | retro_fcat_1279 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | C2:79162684..79162921(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSFCAG00000024015 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 64.56 % |
Parental protein coverage: | 57.35 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | EKAIAFADRLRAVDTEGVEPMESVLEDRCLYLRSDNVVEGNCVEELLQNAHQVVEEYF-VAPPGNISLPK |
.KA..F.D.L...DT..VEPM.SVLEDRCLYLRS.NVVEGNC.E.L.QN.HQV.E.YF...P.GNISL.. | |
Retrocopy | KKAVTFSDQL*TMDTDRVEPMKSVLEDRCLYLRSNNVVEGNCAENLPQNSHQVMEKYFCLLPTGNISLS* |
Parental | QDEQQPFSH |
.DEQ..F.H | |
Retrocopy | LDEQETFLH |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 28 .00 RPM |
SRP017611_kidney | 0 .00 RPM | 52 .15 RPM |
SRP017611_liver | 0 .00 RPM | 23 .15 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000013298 | 1 retrocopy | |
Equus caballus | ENSECAG00000011118 | 1 retrocopy | |
Felis catus | ENSFCAG00000024015 | 1 retrocopy |
retro_fcat_1279 ,
|
Homo sapiens | ENSG00000257218 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000015651 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000009867 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000004226 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000005030 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000005534 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000009907 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000006845 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000000144 | 1 retrocopy |