RetrogeneDB ID: | retro_ptro_2655 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 7:132130082..132130410(-) | ||
| Located in intron of: | ENSPTRG00000022792 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSPTRG00000005534 | ||
| Aliases: | None | ||
| Description: | Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial [Source:UniProtKB/TrEMBL;Acc:H2Q711] |
| Percent Identity: | 76.79 % |
| Parental protein coverage: | 81.48 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | QGSGRITAAVIEHLERLALVDFGSREAVTRLEKAIAFADRLRAVDTDG-VEPMESVLEDRCLYLRSDNVV |
| QGSG.I...VIE.LE.L..VDFGS.EAV.RLEK.I.FA..L...DTDG.VEPMESVLE.RCLYLRS.NVV | |
| Retrocopy | QGSGQIMIEVIEPLEPLVPVDFGSLEAVVRLEKDIIFAHGLHPMDTDG<VEPMESVLEGRCLYLRSNNVV |
| Parental | EGNCADELLQNSHRVVEEYFVAP-PGNISLPKLDEQEPFPHS |
| .GNCA.ELLQNSH.VV.EYFVAP.PGNISLPKLDEQEPF.HS | |
| Retrocopy | GGNCAEELLQNSHCVVKEYFVAP<PGNISLPKLDEQEPFSHS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .04 RPM | 15 .30 RPM |
| SRP007412_cerebellum | 0 .07 RPM | 25 .95 RPM |
| SRP007412_heart | 0 .00 RPM | 6 .85 RPM |
| SRP007412_kidney | 0 .08 RPM | 21 .60 RPM |
| SRP007412_liver | 0 .03 RPM | 13 .75 RPM |
| SRP007412_testis | 0 .00 RPM | 8 .01 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3902 |
| Pongo abelii | retro_pabe_3181 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000013298 | 1 retrocopy | |
| Equus caballus | ENSECAG00000011118 | 1 retrocopy | |
| Felis catus | ENSFCAG00000024015 | 1 retrocopy | |
| Homo sapiens | ENSG00000257218 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000015651 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000009867 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000004226 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000005030 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000005534 | 1 retrocopy |
retro_ptro_2655 ,
|
| Sus scrofa | ENSSSCG00000009907 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000000144 | 1 retrocopy |