RetrogeneDB ID: | retro_ocun_585 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
Coordinates: | 12:129224165..129224386(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSOCUG00000009867 | ||
Aliases: | None | ||
Description: | Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial [Source:UniProtKB/TrEMBL;Acc:G1SY25] |
Percent Identity: | 54.67 % |
Parental protein coverage: | 52.94 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | ADRLRQVDTDGVEPMESVLEDRCLYLRSDNVVEG-NCAEELLQNSHRVVEEYFVAPPGN--IPLPKLDEQ |
...LR.VDTD.V.PMES.LED.CL.L..DN..EG..C.EELLQNS.R..EEYF...P.....P..K.... | |
Retrocopy | SEQLRAVDTDRVGPMESLLEDGCLHLTFDNAGEG<HCEEELLQNSGRGGEEYFAPRPHHEYSPFAKAG*T |
Parental | ESFPH |
E.FPH | |
Retrocopy | ERFPH |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 8 .44 RPM |
SRP017611_kidney | 0 .00 RPM | 9 .73 RPM |
SRP017611_liver | 0 .08 RPM | 4 .01 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000013298 | 1 retrocopy | |
Equus caballus | ENSECAG00000011118 | 1 retrocopy | |
Felis catus | ENSFCAG00000024015 | 1 retrocopy | |
Homo sapiens | ENSG00000257218 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000015651 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000009867 | 2 retrocopies |
retro_ocun_585 , retro_ocun_858,
|
Ochotona princeps | ENSOPRG00000004226 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000005030 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000005534 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000009907 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000006845 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000000144 | 1 retrocopy |