RetrogeneDB ID: | retro_fcat_477 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | A3:68437659..68438054(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | KRTCAP2 | ||
Ensembl ID: | ENSFCAG00000025085 | ||
Aliases: | None | ||
Description: | keratinocyte associated protein 2 [Source:HGNC Symbol;Acc:28942] |
Percent Identity: | 82.71 % |
Parental protein coverage: | 96.32 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | SASMMLSSLL-SLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKG-FQAKIFP |
.AS..LSSLL.SLLLF..MQMYS.QLASTE.LTIQG.LLGSGLF.FSLTAF.NLENLVFGK..FQAKIFP | |
Retrocopy | TASLTLSSLLPSLLLFMEMQMYSPQLASTE*LTIQGTLLGSGLFIFSLTAFSNLENLVFGKD<FQAKIFP |
Parental | EILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQATAPVLAPAKVTGKGKKRN |
EILLCLLLAL.AS.LIHRVCVTTCFIFS.VGL.Y.NKISST.YQATAP.L..AKVT.KGKKRN | |
Retrocopy | EILLCLLLALSASSLIHRVCVTTCFIFSRVGLCYVNKISSTVYQATAPGLTLAKVTRKGKKRN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 14 .12 RPM |
SRP017611_kidney | 0 .00 RPM | 30 .09 RPM |
SRP017611_liver | 0 .00 RPM | 17 .69 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000011336 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000017055 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000009017 | 1 retrocopy | |
Felis catus | ENSFCAG00000025085 | 3 retrocopies |
retro_fcat_1496, retro_fcat_477 , retro_fcat_576,
|
Homo sapiens | ENSG00000163463 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000009303 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000012180 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000005647 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000011864 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000000347 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000030271 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000000756 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000001410 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000020542 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000008829 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000013228 | 2 retrocopies |