RetrogeneDB ID: | retro_mmul_987 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 13:45139149..45139599(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | KRTCAP2 | ||
Ensembl ID: | ENSMMUG00000012180 | ||
Aliases: | None | ||
Description: | keratinocyte associated protein 2 [Source:HGNC Symbol;Acc:28942] |
Percent Identity: | 85.33 % |
Parental protein coverage: | 92.59 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | FLARGAGWTHGRGMMVVGTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFN |
FLARG...TH..GMMVVGTGTSLA.SSLLSLLLF.GMQM.S.QLASTEWLTIQ.GLLGS.LFVFSLTAF. | |
Retrocopy | FLARGDDLTHMQGMMVVGTGTSLAISSLLSLLLFTGMQMCSHQLASTEWLTIQDGLLGSRLFVFSLTAFK |
Parental | NLENLVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQAAAPVLTPA |
.LE.LVFGKG.QAK.FPEILL.LLLALFASGLIH.VCVTTCFIFS.VGL.YINKISSTL.QAAAPVLTPA | |
Retrocopy | ILETLVFGKGSQAKTFPEILLFLLLALFASGLIH*VCVTTCFIFSVVGLCYINKISSTLHQAAAPVLTPA |
Parental | KVTGKSKKRN |
KVTGKSKKR. | |
Retrocopy | KVTGKSKKRH |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 12 .66 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 16 .74 RPM |
SRP007412_cerebellum | 0 .00 RPM | 13 .95 RPM |
SRP007412_heart | 0 .00 RPM | 22 .08 RPM |
SRP007412_kidney | 0 .00 RPM | 37 .91 RPM |
SRP007412_liver | 0 .00 RPM | 55 .77 RPM |
SRP007412_testis | 0 .00 RPM | 84 .02 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2100 |
Pan troglodytes | retro_ptro_1541 |
Gorilla gorilla | retro_ggor_1635 |
Pongo abelii | retro_pabe_1999 |
Callithrix jacchus | retro_cjac_1289 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000011336 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000017055 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000009017 | 1 retrocopy | |
Felis catus | ENSFCAG00000025085 | 3 retrocopies | |
Homo sapiens | ENSG00000163463 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000009303 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000012180 | 2 retrocopies |
retro_mmul_745, retro_mmul_987 ,
|
Mustela putorius furo | ENSMPUG00000005647 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000011864 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000000347 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000030271 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000000756 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000001410 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000020542 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000008829 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000013228 | 2 retrocopies |