RetrogeneDB ID: | retro_ggor_1891 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 3:146049019..146049315(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | GM2A | ||
Ensembl ID: | ENSGGOG00000015302 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 72.82 % |
Parental protein coverage: | 52.85 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | QSLMQSPLLIALGLLLA-APAQAHLKKPSQLSSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVVG |
QSL.Q....IALGLLLA.AP.QA.LKK...LSSFSW.NCDEGKDPAVIR..TLEPDPII.P.NVTLS..G | |
Retrocopy | QSLTQASPQIALGLLLA<APVQARLKK---LSSFSWNNCDEGKDPAVIRGVTLEPDPIILPENVTLSLLG |
Parental | STSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYI |
ST.V.LSS.L..DLVLEKEVAGLWIK.P...Y. | |
Retrocopy | STTVSLSSRLEMDLVLEKEVAGLWIKTPWQLYL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 25 .61 RPM |
SRP007412_cerebellum | 0 .00 RPM | 27 .18 RPM |
SRP007412_heart | 0 .00 RPM | 16 .14 RPM |
SRP007412_kidney | 0 .00 RPM | 27 .23 RPM |
SRP007412_liver | 0 .00 RPM | 32 .13 RPM |
SRP007412_testis | 0 .00 RPM | 28 .18 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2715 |
Pan troglodytes | retro_ptro_1834 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Equus caballus | ENSECAG00000020587 | 1 retrocopy | |
Homo sapiens | ENSG00000196743 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000015302 | 2 retrocopies |
retro_ggor_1891 , retro_ggor_313,
|
Macropus eugenii | ENSMEUG00000010421 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000000690 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000003215 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000022869 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000010966 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000015837 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000006171 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000015962 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000017431 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000028500 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000000503 | 1 retrocopy |