RetrogeneDB ID: | retro_itri_1087 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
Coordinates: | JH393373.1:1102019..1102252(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDUFC1 | ||
Ensembl ID: | ENSSTOG00000023590 | ||
Aliases: | None | ||
Description: | NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 1, 6kDa [Source:HGNC Symbol;Acc:7705] |
Percent Identity: | 62.03 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MAPSALLRHFS-RLLAP-ARLPSGACARSKFYLRDPPN-DQPDWLKVGLTLGTTAFLWFYLIKQHDEDVL |
.APS.LL..FS.R...P.ARL.S...ARSKFYL.D.P.....D.LK.GLTLGT..FLW..LIKQH..DVL | |
Retrocopy | LAPSVLLCPFS<RAADPTARLQSHPSARSKFYLPDSPKLNKSD*LKLGLTLGTNSFLWSSLIKQHNQDVL |
Parental | EYKRRNSLE |
EYKRRN.L. | |
Retrocopy | EYKRRNCLD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000011040 | 2 retrocopies | |
Bos taurus | ENSBTAG00000039582 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000015639 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000004800 | 11 retrocopies | |
Felis catus | ENSFCAG00000008548 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000010459 | 5 retrocopies | |
Microcebus murinus | ENSMICG00000006836 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000009082 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000023590 | 3 retrocopies |
retro_itri_1087 , retro_itri_1109, retro_itri_1202,
|
Tursiops truncatus | ENSTTRG00000001107 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000007703 | 1 retrocopy |