RetrogeneDB ID: | retro_itri_1334 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
Coordinates: | JH393445.1:2504327..2504537(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SRP14 | ||
Ensembl ID: | ENSSTOG00000015627 | ||
Aliases: | None | ||
Description: | signal recognition particle 14kDa (homologous Alu RNA binding protein) [Source:HGNC Symbol;Acc:11299] |
Percent Identity: | 92.86 % |
Parental protein coverage: | 63.64 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | PRKGSVEGVEPSDNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLLRANMDGLKKRDKKSKSKKSKAAQ |
PRKGSVEGVEPSDNKCLLRA.DGKKKI.T.VSSKEVN.FQMAYSNLLRANMDGLKKR.KKSKSKKSKAAQ | |
Retrocopy | PRKGSVEGVEPSDNKCLLRAMDGKKKIITMVSSKEVNTFQMAYSNLLRANMDGLKKRQKKSKSKKSKAAQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000029889 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000020912 | 3 retrocopies | |
Equus caballus | ENSECAG00000000319 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000011870 | 1 retrocopy | |
Felis catus | ENSFCAG00000030207 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000009921 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000007637 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000016061 | 4 retrocopies | |
Monodelphis domestica | ENSMODG00000029204 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000008324 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000029070 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000006342 | 3 retrocopies | |
Pteropus vampyrus | ENSPVAG00000002186 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000015627 | 9 retrocopies |
retro_itri_1334 , retro_itri_1501, retro_itri_1633, retro_itri_382, retro_itri_432, retro_itri_707, retro_itri_710, retro_itri_799, retro_itri_824,
|
Tursiops truncatus | ENSTTRG00000000036 | 5 retrocopies | |
Vicugna pacos | ENSVPAG00000010282 | 1 retrocopy |