RetrogeneDB ID: | retro_pabe_262 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 1:79764412..79764631(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SRP14 | ||
| Ensembl ID: | ENSPPYG00000006342 | ||
| Aliases: | None | ||
| Description: | Signal recognition particle 14 kDa protein [Source:UniProtKB/Swiss-Prot;Acc:Q5RBX7] |
| Percent Identity: | 73.33 % |
| Parental protein coverage: | 56.39 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | GRTKPIPKKGTVEGFEPADNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKTK |
| G.TKPI.KKG.V.GFE..D..CLLR.TDGKKK.S.V.SSKEVNKF..AYSNLL..NMDGLKKRDKKN.T. | |
| Retrocopy | G*TKPILKKGSVVGFESSD-RCLLRTTDGKKKFSIVLSSKEVNKFRVAYSNLLTTNMDGLKKRDKKN-TS |
| Parental | KTKAA |
| ..KAA | |
| Retrocopy | NIKAA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .66 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 1 .34 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .27 RPM |
| SRP007412_kidney | 0 .03 RPM | 0 .56 RPM |
| SRP007412_liver | 0 .06 RPM | 0 .34 RPM |