RetrogeneDB ID: | retro_itri_467 | ||
Retrocopy location | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393293.1:6088373..6088604(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSSTOG00000010338 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 73.42 % |
| Parental protein coverage: | 63.2 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | LLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQT |
| LL.EHQA.Q...KELQ.K.RRE.ITAAT.L.EALVDHL.VGVAQA..NQRKLDHE...LQVQAA..AK.T | |
| Retrocopy | LL*EHQA*QKGHKELQKKMRRETITAATFLAEALVDHLIVGVAQACTNQRKLDHE--SLQVQAAKSAK*T |
| Parental | GQWIGMVEN |
| GQWI.M.EN | |
| Retrocopy | GQWIKMEEN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000011918 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000008026 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000001818 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000001570 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000010114 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000000359 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000010338 | 1 retrocopy |
retro_itri_467 ,
|