RetrogeneDB ID: | retro_lafr_859 | ||
Retrocopy location | Organism: | Elephant (Loxodonta africana) | |
| Coordinates: | scaffold_403:19209..19577(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RBPMS2 | ||
| Ensembl ID: | ENSLAFG00000018725 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 51.97 % |
| Parental protein coverage: | 68.89 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | SLIKLTSRQPVGFVIFDS-RAGAEAAKNALNGIRFDPENPQTLRLEFAKANTKMAKSKLMATPNPTSA-H |
| SLIK..SRQPVGFV.FDS..A..E.AK....GI.F...N.QTLR......N.KM.K..LM.T.N.T...H | |
| Retrocopy | SLIKFISRQPVGFVTFDS>GAEVEVAKYMSSGICFHFSNQQTLRFRVFQSNIKMTKKGLMVTSNSTKS<H |
| Parental | PALGAHFIARDPYDLMGAALIPASPEAW-APYPLYTTELTPAISHAAFTYPAATAAT |
| ..LGAHFI..D.YDL.G.ALI..S.E.W...Y..Y.T.L.P.I.H..FTY...T..T | |
| Retrocopy | SSLGAHFIV-DSYDLLGEALIFMSLEVW<VLYIMYPTKLIPGITHDGFTYSHTTDIT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000011037 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000005200 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000004025 | 1 retrocopy | |
| Homo sapiens | ENSG00000166831 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000008984 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000018725 | 6 retrocopies | |
| Macaca mulatta | ENSMMUG00000013270 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000010487 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000032387 | 9 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000012505 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000026017 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000006553 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000007165 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000004549 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000010055 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000008996 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000011840 | 3 retrocopies |