RetrogeneDB ID: | retro_mdom_1227 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 4:26419132..26419452(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDUFS4 | ||
Ensembl ID: | ENSMODG00000019465 | ||
Aliases: | None | ||
Description: | NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase) [Source:HGNC Symbol;Acc:7711] |
Percent Identity: | 53.21 % |
Parental protein coverage: | 62.57 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | EEHIKTRKVQIFVPARNNMQSGVNNTKKWKMEF-DTRERWENPLMGWASTADPLSNLVLSFSTKEDAVAF |
...IKTRK.QIFV.A..NM.SGV..TK.WK.E..D.RE.WEN.LM.W....DPLS.L.L..........F | |
Retrocopy | QRNIKTRKIQIFVSAHSNMKSGVSDTKTWKQEL<DIRECWENLLMVWTLMVDPLSLLILQY*RRCNYI-F |
Parental | AEKNGWSYDIQERRVPK-PKSKSYGANFSWNKRTRVSTK |
..K...S.DIQER......KSKSYG.NFSWN.RT...TK | |
Retrocopy | ERKKD*SSDIQERKSYNLNKSKSYGINFSWNRRTKMFTK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Cavia porcellus | ENSCPOG00000005452 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000015851 | 3 retrocopies | |
Macropus eugenii | ENSMEUG00000001362 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000015138 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000019465 | 1 retrocopy |
retro_mdom_1227 ,
|
Mus musculus | ENSMUSG00000021764 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000013784 | 1 retrocopy | |
Procavia capensis | ENSPCAG00000013496 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000015455 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000016893 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000004605 | 1 retrocopy |