RetrogeneDB ID: | retro_mdom_1446 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 5:90574789..90575225(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CENPK | ||
| Ensembl ID: | ENSMODG00000019645 | ||
| Aliases: | None | ||
| Description: | centromere protein K [Source:HGNC Symbol;Acc:29479] |
| Percent Identity: | 64.86 % |
| Parental protein coverage: | 53.7 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 1 |
| Parental | REQEWLNEQEHLVTSLSKKCKERKNQVIPFSEQRTFFEMNTKMTKIQSQREKLLNSLGEFLDKHFPPP-E |
| .EQ.WLNEQE.LV....K.....K.....F........M.TKMT.IQ..REKLL.SLGEFLDKHFP.P.. | |
| Retrocopy | QEQQWLNEQEQLVIFQ*KM*GTKKSSDTIF*AKDXXXKMKTKMTNIQRYREKLLTSLGEFLDKHFPFP>X |
| Parental | ENGN-KRKRECKPTAQLKTLREILEVLINSLL-RSPYNPYVKIDDSYWPPYIELLLRNGIALRHQDDPNQ |
| ..GN.KRKRECKPTAQLKTL.EILEV.IN.LL..SP..PY..I.DS.WPPYIELLL..GIA.RHQDDPNQ | |
| Retrocopy | XXGNKKRKRECKPTAQLKTLHEILEVHINCLLQKSPHDPY--INDSFWPPYIELLLHRGIAIRHQDDPNQ |
| Parental | IRLEAFHQ |
| I.LE.FHQ | |
| Retrocopy | I*LEVFHQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000013993 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000007357 | 1 retrocopy | |
| Equus caballus | ENSECAG00000019165 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000005831 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000019645 | 1 retrocopy |
retro_mdom_1446 ,
|
| Oryctolagus cuniculus | ENSOCUG00000011568 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000006527 | 1 retrocopy |