RetrogeneDB ID: | retro_mdom_600 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 1:472571773..472572187(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COQ10B | ||
Ensembl ID: | ENSMODG00000012281 | ||
Aliases: | None | ||
Description: | coenzyme Q10 homolog B (S. cerevisiae) [Source:HGNC Symbol;Acc:25819] |
Percent Identity: | 73.57 % |
Parental protein coverage: | 57.02 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | RTFFKIAAPLINKRKEYSERRIIGYSMQEMYDVVSGMEDYKNFVPWCKKSDVISKRSGYCKTR-LEIGFP |
R...............YSERRI.GYSMQEMYDVVSGMEDYKNFVP..KKSDVISK.SGYCKT..LEIGFP | |
Retrocopy | RSLQELSSKFXXXXNDYSERRILGYSMQEMYDVVSGMEDYKNFVPCGKKSDVISKKSGYCKTM>LEIGFP |
Parental | PVLERYTSIVTLVKPHLVKASCTDGKLFNH-LETVWRFSPGLPGYPRTCTVDFSISFEFRSLLHSQLATL |
.VLE.YTSIVTLVKPHLVKASCTDGKL.NH.L..VW.FS..LP..P.TCTV.FSISFEF.SLLHSQ..TL | |
Retrocopy | SVLE*YTSIVTLVKPHLVKASCTDGKLSNH<LKIVWCFSSDLPR*PMTCTVNFSISFEFHSLLHSQFFTL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .20 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000004659 | 2 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000005807 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000003971 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000003229 | 2 retrocopies | |
Dipodomys ordii | ENSDORG00000004090 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000001626 | 1 retrocopy | |
Felis catus | ENSFCAG00000022385 | 1 retrocopy | |
Homo sapiens | ENSG00000115520 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000023373 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000000865 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000010488 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000012281 | 1 retrocopy |
retro_mdom_600 ,
|
Mus musculus | ENSMUSG00000025981 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000006871 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000010091 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000013045 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000012772 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000014456 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000012642 | 2 retrocopies |