RetrogeneDB ID: | retro_pabe_576 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 10:25655485..25655899(-) | ||
Located in intron of: | ENSPPYG00000002156 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COQ10B | ||
Ensembl ID: | ENSPPYG00000013045 | ||
Aliases: | None | ||
Description: | Coenzyme Q-binding protein COQ10 homolog B, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q5RD79] |
Percent Identity: | 75.71 % |
Parental protein coverage: | 58.82 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | SATAAGAQAPVRNGRYLASCGILMSRTLPLHTSILPKEICARTFFKITAPLINKRKEYSERRILGYSMQE |
S....G...P..N.RYLASCGILMSR.LPLH.S.L.KEICA.TFF.I.APLINKRK.YSERRILGY.MQE | |
Retrocopy | SGRSPGSEGPEQNIRYLASCGILMSRALPLHMSFLIKEICAITFFTIAAPLINKRK-YSERRILGYLMQE |
Parental | MYDVVSGVEDYKHFVPWCKKSDVISKRSGYCKTRLEIGFPPVLERYTSVVTLVKPHLVKASCTDGRLFNH |
MYDVV.G.EDYKHF..WCKKSD.IS.RSGY.KT.LEI.FP.VLE.Y.S.VTLVKPHLVK.SCTDGRLF.H | |
Retrocopy | MYDVVLGMEDYKHFILWCKKSDIISERSGYYKTQLEIEFPAVLE*Y-SAVTLVKPHLVKVSCTDGRLFKH |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .06 RPM | 15 .09 RPM |
SRP007412_cerebellum | 0 .00 RPM | 10 .34 RPM |
SRP007412_heart | 0 .00 RPM | 14 .75 RPM |
SRP007412_kidney | 0 .00 RPM | 15 .31 RPM |
SRP007412_liver | 0 .00 RPM | 11 .05 RPM |
Species | RetrogeneDB ID |
---|---|
Gorilla gorilla | retro_ggor_569 |
Macaca mulatta | retro_mmul_2434 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000004659 | 2 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000005807 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000003971 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000003229 | 2 retrocopies | |
Dipodomys ordii | ENSDORG00000004090 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000001626 | 1 retrocopy | |
Felis catus | ENSFCAG00000022385 | 1 retrocopy | |
Homo sapiens | ENSG00000115520 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000023373 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000000865 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000010488 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000012281 | 1 retrocopy | |
Mus musculus | ENSMUSG00000025981 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000006871 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000010091 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000013045 | 2 retrocopies |
retro_pabe_2758, retro_pabe_576 ,
|
Pan troglodytes | ENSPTRG00000012772 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000014456 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000012642 | 2 retrocopies |