RetrogeneDB ID: | retro_rnor_1620 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 2:72057321..72057696(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Coq10b | ||
Ensembl ID: | ENSRNOG00000014456 | ||
Aliases: | Coq10b, RGD1359509 | ||
Description: | Coenzyme Q-binding protein COQ10 homolog B, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q5I0I9] |
Percent Identity: | 84.62 % |
Parental protein coverage: | 52.89 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | SDILSRRSGYCKTRLEIGFPPVLERYTSIVTLVKPHLVKASCTDGKLFNHLETVWRFS-PGLPGYPRTCT |
SDI.SRRSGYC.TRLEIGFP.VLE.YTSIV.LVKPHLVKASC.DGKLFNHLET.W..S.PG...YPRTCT | |
Retrocopy | SDIISRRSGYCRTRLEIGFPSVLEQYTSIVILVKPHLVKASCSDGKLFNHLETIWPRS>PG---YPRTCT |
Parental | LDFSIS-FEFRSLLHSQLATLFFDEVVKQMVAAFERRACKLYGPETNIPRELMLHEIHHT |
LDFSIS.FEF.SLLHSQL..LFFDEVVKQMVAAFERR.CKLYG.ETNIP.ELMLHEIHHT | |
Retrocopy | LDFSIS<FEFHSLLHSQLTPLFFDEVVKQMVAAFERRTCKLYGSETNIPQELMLHEIHHT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 13 .95 RPM |
SRP017611_kidney | 0 .00 RPM | 37 .05 RPM |
SRP017611_liver | 0 .00 RPM | 11 .77 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000004659 | 2 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000005807 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000003971 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000003229 | 2 retrocopies | |
Dipodomys ordii | ENSDORG00000004090 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000001626 | 1 retrocopy | |
Felis catus | ENSFCAG00000022385 | 1 retrocopy | |
Homo sapiens | ENSG00000115520 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000023373 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000000865 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000010488 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000012281 | 1 retrocopy | |
Mus musculus | ENSMUSG00000025981 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000006871 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000010091 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000013045 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000012772 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000014456 | 1 retrocopy |
retro_rnor_1620 ,
|
Tarsius syrichta | ENSTSYG00000012642 | 2 retrocopies |