RetrogeneDB ID: | retro_meug_143 | ||
Retrocopylocation | Organism: | Wallaby (Macropus eugenii) | |
Coordinates: | GeneScaffold_4167:16420..16786(-) | ||
Located in intron of: | ENSMEUG00000011309 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C1orf146 | ||
Ensembl ID: | ENSMEUG00000013311 | ||
Aliases: | None | ||
Description: | chromosome 1 open reading frame 146 [Source:HGNC Symbol;Acc:24032] |
Percent Identity: | 51.59 % |
Parental protein coverage: | 68.51 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 2 |
Parental | MAESRGKEKVKW-ITTIIMSSSLQNLEVSVILKNENHRIRFSNSVEPGSIIFPLSGVAFLLLEAQDCFMT |
..ES..KEKVK..IT.IIMSS.LQ..EV..I.K.E.H.I..SNS.....IIF..S...FL...AQD..M. | |
Retrocopy | VTESKEKEKVKG<ITRIIMSSILQS*EVTTIFKKESHGICYSNSI*FEPIIFSVSVSPFLIINAQDHLMI |
Parental | TEEILLAQIEKFMRIHRNS-FLALCSALHGPREWRLMFRIQQRFLGDNLRIIPVHN |
TEE..LAQ.E.F.RI.RN...L.....LH.P.E.....R...R.LGDNL.I.PVHN | |
Retrocopy | TEETFLAQTERFTRIIRNT>ALVRSAPLHSPEE*MEFKRL--RLLGDNLPIVPVHN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000027936 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000004012 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000017547 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000003083 | 1 retrocopy | |
Homo sapiens | ENSG00000203910 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000006653 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000013311 | 1 retrocopy |
retro_meug_143 ,
|
Myotis lucifugus | ENSMLUG00000016984 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000010094 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000010426 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000001156 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000030530 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000012506 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000014426 | 1 retrocopy |