RetrogeneDB ID: | retro_meug_1990 | ||
Retrocopylocation | Organism: | Wallaby (Macropus eugenii) | |
Coordinates: | Scaffold77326:9166..9402(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C3orf14 | ||
Ensembl ID: | ENSMEUG00000013085 | ||
Aliases: | None | ||
Description: | chromosome 3 open reading frame 14 [Source:HGNC Symbol;Acc:25024] |
Percent Identity: | 75. % |
Parental protein coverage: | 61.24 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | GMAYFAKEVQLTKKHEEILAQRLLLLEEMEKEHGGQKTE-KKASYLKAAKLANKRNQSLLNDIRTLEEKL |
GMAYFAKEV.LTKKHEEILAQRLLLLEEME..H.GQKTE.KKA...KAAKLA.KRN.SLLN..RTLEEKL | |
Retrocopy | GMAYFAKEV*LTKKHEEILAQRLLLLEEMENNHSGQKTE<KKAFHIKAAKLAYKRNWSLLNNLRTLEEKL |
Parental | EKNAHLQSQI |
.......S.I | |
Retrocopy | XXXXYIYSHI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000015374 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000007123 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000004965 | 7 retrocopies | |
Erinaceus europaeus | ENSEEUG00000000474 | 1 retrocopy | |
Felis catus | ENSFCAG00000027983 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000013085 | 2 retrocopies |
retro_meug_1990 , retro_meug_2091,
|
Microcebus murinus | ENSMICG00000016406 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000016914 | 1 retrocopy | |
Mus musculus | ENSMUSG00000033111 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000008107 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000017312 | 1 retrocopy |